Description

  • Product name

    Recombinant Mouse GALNT1 protein (His tag)
    See all GALNT1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ADPGLPAGDVLELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLM ASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVH SVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRS GLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPI IDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVR TPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIV TCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPG VTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNV ETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSK LNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSI RDCTGSRSQQWLLRNVTLPEIFHHHHHH
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      41 to 559
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_038842. Product corresponds to the soluble form of GALNT1.

Specifications

Our Abpromise guarantee covers the use of ab227406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • GALNAC T1
    • GalNAc transferase 1
    • GalNAc-T1
    • GALNT 1
    • GALNT1
    • GALT1_HUMAN
    • Polypeptide GalNAc transferase 1
    • Polypeptide N acetylgalactosaminyltransferase 1
    • Polypeptide N-acetylgalactosaminyltransferase 1 soluble form
    • pp GaNTase 1
    • pp-GaNTase 1
    • Protein UDP acetylgalactosaminyltransferase 1
    • Protein-UDP acetylgalactosaminyltransferase 1
    • UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 1
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 1
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 1 (GalNAc T1)
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1
    see all
  • Function

    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7.
  • Tissue specificity

    Widely expressed. Expressed in all tissues tested.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain

    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain directs the glycopeptide specificity. It is required in the glycopeptide specificity of enzyme activity but not for activity with naked peptide substrates, suggesting that it triggers the catalytic domain to act on GalNAc-glycopeptide substrates.
  • Cellular localization

    Secreted and Golgi apparatus > Golgi stack membrane.
  • Information by UniProt

Images

  • ab227406 (3 μg) analysed by 15% SDS-PAGE.

References

ab227406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up