Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMVKVGVNGFGRIGRLVTRAAICSGKVE IVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQE RDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAP MFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVH AITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLT GMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTED QVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMA YMASKE
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 333
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_032110.

Specifications

Our Abpromise guarantee covers the use of ab202148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    ab202148 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 20% Glycerol, 0.02% DTT, 79% PBS

General Info

  • Alternative names
    • 38 kDa BFA-dependent ADP-ribosylation substrate
    • aging associated gene 9 protein
    • Aging-associated gene 9 protein
    • BARS-38
    • cb609
    • EC 1.2.1.12
    • Epididymis secretory sperm binding protein Li 162eP
    • G3P_HUMAN
    • G3PD
    • G3PDH
    • GAPD
    • GAPDH
    • Glyceraldehyde 3 phosphate dehydrogenase
    • Glyceraldehyde-3-phosphate dehydrogenase
    • HEL-S-162eP
    • KNC-NDS6
    • MGC102544
    • MGC102546
    • MGC103190
    • MGC103191
    • MGC105239
    • MGC127711
    • MGC88685
    • OCAS, p38 component
    • OCT1 coactivator in S phase, 38-KD component
    • peptidyl cysteine S nitrosylase GAPDH
    • Peptidyl-cysteine S-nitrosylase GAPDH
    • wu:fb33a10
    see all
  • Function
    Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC (By similarity). Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate.
  • Pathway
    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 1/5.
  • Sequence similarities
    Belongs to the glyceraldehyde-3-phosphate dehydrogenase family.
  • Post-translational
    modifications
    S-nitrosylation of Cys-152 leads to interaction with SIAH1, followed by translocation to the nucleus.
    ISGylated.
  • Cellular localization
    Cytoplasm > cytosol. Nucleus. Cytoplasm > perinuclear region. Membrane. Translocates to the nucleus following S-nitrosylation and interaction with SIAH1, which contains a nuclear localization signal (By similarity). Postnuclear and Perinuclear regions.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202148 (3 µg).

References

ab202148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up