Description

  • Product name

    Recombinant Mouse GCET1 protein (His tag)
  • Purity

    > 85 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      NPYNQESSHLPSMKKNPASQVSPSNTRFSFLLYQRLAQEN PGQNILFSPV SISTSLAMLS LGARSATKTQ ILRTLGFNFT WVSEPTIHMGFEYLVRSLNKCHQGRELRMGSVLFIRKELQLQATFLDRVK KLYGAKVFSEDFSNAATAQAQINSYVEKETKGKVVDVIQDLDSQTAMVLV NHIFFKANWTQPFSTANTNKSFPFLLSKGTTVHVPMMHQTESFAFGVDKE LGCSILQMDYRGDAVAFFVLPGKGKMRQLEKSLSARRLRKWSRSLQKRWI KVFIPKFSISASYNLETILPKMGIRDAFNSNADFSGITKTHFLQVSKAAH KAVLDVSEEGTEAAAATTTKLIVRSRDTPSSIIAFKEPFLILLLDKNTES VLFLGKVENPRKMLEHHHHHH
    • Predicted molecular weight

      45 kDa
    • Amino acids

      26 to 418
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab219454 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • Centerin
    • GCET1
    • Germinal center B cell expressed transcript 1
    • Germinal center B-cell-expressed transcript 1 protein
    • Seprin A9
    • Serine proteinase inhibitor A11
    • Serpin A9
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 9
    • Serpin peptidase inhibitor clade A member 9
    • SERPINA11
    • SERPINA11b
    • Serpina9
    • SPA9_HUMAN
    see all
  • Function

    Protease inhibitor that inhibits trypsin and trypsin-like serine proteases (in vitro). Inhibits plasmin and thrombin with lower efficiency (in vitro).
  • Tissue specificity

    Highly expressed in normal germinal center (GC) B-cells and GC B-cell-derived malignancies.
  • Sequence similarities

    Belongs to the serpin family.
  • Cellular localization

    Cytoplasm; Secreted and Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE using 3ug of ab219454.

References

ab219454 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219454.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up