Description

  • Product name

    Recombinant Mouse GDF15 protein (denatured)
    See all GDF15 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSSAHAHPRDSCPLGPGRCCHLETVQATL EDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVP APCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      189 to 303
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 189 to 303. The signal peptide and propeptide are not included. (NP_035949).

Specifications

Our Abpromise guarantee covers the use of ab202199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 90% Phosphate Buffer, 10% Glycerol

General Info

  • Alternative names

    • GDF 15
    • GDF-15
    • Gdf15
    • GDF15_HUMAN
    • Growth differentiation factor 15
    • Growth/differentiation factor 15
    • Macrophage inhibitory cytokine 1
    • MIC 1
    • Mic-1
    • MIC1
    • NAG 1
    • NAG-1
    • NAG1
    • NRG 1
    • NRG-1
    • NRG1
    • NSAID
    • NSAID (nonsteroidal anti inflammatory drug) activated protein 1
    • NSAID regulated protein 1
    • NSAID-activated gene 1 protein
    • NSAID-regulated gene 1 protein
    • PDF
    • PLAB
    • Placental bone morphogenetic protein
    • Placental bone morphogenic protein
    • Placental TGF beta
    • Placental TGF-beta
    • Prostate differentiation factor
    • PTGF beta
    • PTGFB
    see all
  • Tissue specificity

    Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202199 (3 µg).

References

ab202199 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202199.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up