Description

  • Product name

    Recombinant Mouse GFAP protein (His tag)
    See all GFAP proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MERRRITSARRSYASETVVRGLGPSRQLGTMPRFSLSRMTPPLPARVDFS LAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQ LRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQ KLQDETNLRLEAENNLAAYRQEADEATLARVDLERKVESLEEEIQFLRKI YEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQET EEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTN ESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLL NVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGH LKRNIVVKTVEMRDGEVIKDSKQEHKDVVM
    • Predicted molecular weight

      66 kDa including tags
    • Amino acids

      1 to 430
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab226309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • wu:fb34h11
    • ALXDRD
    • cb345
    • etID36982.3
    • FLJ42474
    • FLJ45472
    • GFAP
    • GFAP_HUMAN
    • gfapl
    • Glial fibrillary acidic protein
    • Intermediate filament protein
    • wu:fk42c12
    • xx:af506734
    • zgc:110485
    see all
  • Function

    GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
  • Tissue specificity

    Expressed in cells lacking fibronectin.
  • Involvement in disease

    Defects in GFAP are a cause of Alexander disease (ALEXD) [MIM:203450]. Alexander disease is a rare disorder of the central nervous system. It is a progressive leukoencephalopathy whose hallmark is the widespread accumulation of Rosenthal fibers which are cytoplasmic inclusions in astrocytes. The most common form affects infants and young children, and is characterized by progressive failure of central myelination, usually leading to death usually within the first decade. Infants with Alexander disease develop a leukoencephalopathy with macrocephaly, seizures, and psychomotor retardation. Patients with juvenile or adult forms typically experience ataxia, bulbar signs and spasticity, and a more slowly progressive course.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    Phosphorylated by PKN1.
  • Cellular localization

    Cytoplasm. Associated with intermediate filaments.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226309 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226309 could indicate that this peptide derived from E.coli-expressed mouse GFAP.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226309 could indicate that this peptide derived from E.coli-expressed mouse GFAP.

References

ab226309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up