Description

  • Product name

    Recombinant mouse GLO1 protein (His tag)
    See all GLO1 proteins and peptides
  • Biological activity

    Specific activity is > 210 units/mg, and is defined as the amount of enzyme that will form 1.0 µmol of S-lactoylglutathione from methylglyoxal and reduced glutathione per minute at pH 6.5 at 25C.

  • Purity

    > 95 % SDS-PAGE.
    Purified by conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYT RVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLE LTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFV KKPDDGKMKGLAFIQDPDGYWIEILNPNKIATIILEHHHHHH
    • Predicted molecular weight

      21 kDa including tags
    • Amino acids

      1 to 184
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab222435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Aldoketomutase
    • glo1
    • GLOD1
    • Glx I
    • GLYI
    • glyoxalase domain containing 1
    • Glyoxalase I
    • Ketone aldehyde mutase
    • Ketone-aldehyde mutase
    • Lactoyl glutathione lyase
    • Lactoylglutathione lyase
    • LGUL_HUMAN
    • Methylglyoxalase
    • S D lactoylglutathione methylglyoxal lyase
    • S-D-lactoylglutathione methylglyoxal lyase
    see all
  • Function

    Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.
  • Pathway

    Secondary metabolite metabolism; methylglyoxal degradation; (R)-lactate from methylglyoxal: step 1/2.
  • Sequence similarities

    Belongs to the glyoxalase I family.
  • Information by UniProt

Images

  • ab222435 (3 μg) analysed on a 15% SDS-PAGE gel.

References

ab222435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up