Description

  • Product name

    Recombinant Mouse Glutaminyl cyclase protein (His tag)
    See all Glutaminyl cyclase proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGS YSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRH LVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDV SGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRG TNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLL KDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDD NEENLHASTIDNLNKIIQVFVLEYLHL
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      36 to 362
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 36 to 362. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226282 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as QPCT.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • 5730422A13Rik
    • EC
    • GCT
    • Glutaminyl cyclase
    • Glutaminyl peptide cyclotransferase
    • Glutaminyl tRNA cyclotransferase
    • Glutaminyl-peptide cyclotransferase
    • Glutaminyl-tRNA cyclotransferase
    • Glutamyl cyclase
    • QC
    • qpct
    • QPCT_HUMAN
    • sQC
    see all
  • Function

    Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.
  • Sequence similarities

    Belongs to the glutaminyl-peptide cyclotransferase family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226282 with 5% enrichment gel and 15% separation gel.

References

ab226282 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226282.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up