Recombinant Mouse Glutaredoxin 1 protein (His tag) (ab227407)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAQEFVNCKIQSGKVVVFIKPTCPYCR KTQEILSQLPFKQGLLEFVDITATNNTSAIQDYLQQLTGARTVPRVFIGK DCIGGCSDLISMQQTGELMTRLKQIGALQL
    • Molecular weight
      14 kDa including tags
    • Amino acids
      1 to 107
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_444338

Specifications

Our Abpromise guarantee covers the use of ab227407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 5.00
    Constituents: 0.39% MES, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • GLRX
    • Glrx1
    • GLRX1_HUMAN
    • Glutaredoxin
    • Glutaredoxin-1
    • Glutaredoxin1
    • Grx
    • Grx 1
    • Grx1
    • MGC117407
    • Thioltransferase
    • Thioltransferase 1
    • Thioltransferase-1
    • Thioltransferase1
    • TTase
    • TTase 1
    • TTase-1
    • TTase1
    see all
  • Function
    Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.
  • Sequence similarities
    Belongs to the glutaredoxin family.
    Contains 1 glutaredoxin domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab227407 (3 μg) analysed by 15% SDS-PAGE.

References

ab227407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up