Description

  • Product name

    Recombinant Mouse Glutathione S Transferase pi protein
    See all Glutathione S Transferase pi proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab219251 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MPPYTIVYFPSPGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLY GQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKNQREAAQVDMVNDGVEDL RGKYGTMIYRNYENGKNDYVKALPGHLKPFETLLSQNQGGKAFIVGDQIS FADYNLLDLLLIHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPEHV NRPINGNGKQ
    • Predicted molecular weight

      24 kDa
    • Amino acids

      1 to 210

Specifications

Our Abpromise guarantee covers the use of ab219251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 20% Glycerol, PBS

General Info

  • Alternative names

    • Deafness X linked 7
    • DFN7
    • FAEES3
    • Fatty acid ethyl ester synthase III
    • Glutathione S transferase pi 1
    • Glutathione S-transferase P
    • GST class-pi
    • GST3
    • Gstp1
    • GSTP1-1
    • GSTP1_HUMAN
    • GSTpi
    • PI
    see all
  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
  • Sequence similarities

    Belongs to the GST superfamily. Pi family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab219251 (3µg).

References

ab219251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up