Recombinant Mouse Glycophorin A protein (Fc Chimera His Tag) (ab219896)

Description

  • Product name

    Recombinant Mouse Glycophorin A protein (Fc Chimera His Tag)
    See all Glycophorin A proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVA STVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPI QHDFPALV
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      1 to 108
    • Tags

      His tag C-Terminus , proprietary tag N-Terminus
    • Additional sequence information

      Extracellular domain of Glycophorin A. Fused with human IgG1 Fc tag at the N terminus.

Specifications

Our Abpromise guarantee covers the use of ab219896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 5% Trehalose, 0.61% Tris buffer, 0.75% Glycine

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • AI853584
    • Blood group--MN locus
    • CD_antigen=CD235a
    • CD235a
    • GLPA_HUMAN
    • Glycophorin A
    • Glycophorin A (MNS blood group)
    • Glycophorin A, included
    • Glycophorin-A
    • GlycophorinA
    • GPA
    • GPErik
    • GpMiIII
    • GPSAT
    • GYPA
    • GYPA, included
    • HGpMiIII
    • HGpMiV
    • HGpMiX
    • HGpMiXI
    • HGpSta(C)
    • MN
    • MN sialoglycoprotein
    • MNS
    • PAS-2
    • PAS2
    • Sialoglycoprotein alpha
    see all
  • Function

    Glycophorin A is the major intrinsic membrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte membrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma membrane. Is a receptor for influenza virus. Is a receptor for Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175); binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans. Appears to be a receptor for Hepatitis A virus (HAV).
  • Sequence similarities

    Belongs to the glycophorin A family.
  • Post-translational
    modifications

    The major O-linked glycan are NeuAc-alpha-(2-3)-Gal-beta-(1-3)-[NeuAc-alpha-(2-6)]-GalNacOH (about 78 %) and NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH (17 %). Minor O-glycans (5 %) include NeuAc-alpha-(2-3)-Gal-beta-(1-3)-[NeuAc-alpha-(2-6)]-GalNAcOH NeuAc-alpha-(2-8)-NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH. About 1% of all O-linked glycans carry blood group A, B and H determinants. They derive from a type-2 precursor core structure, Gal-beta-(1,3)-GlcNAc-beta-1-R, and the antigens are synthesized by addition of fucose (H antigen-specific) and then N-acetylgalactosamine (A antigen-specific) or galactose (B antigen-specific). Specifically O-linked-glycans are NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH-(6-1)-GlcNAc-beta-(4-1)-[Fuc-alpha-(1-2)]-Gal-beta-(3-1)-GalNAc-alpha (about 1%, B antigen-specific) and NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH-(6-1)-GlcNAc-beta-(4-1)-[Fuc-alpha-(1-2)]-Gal-beta (1 %, O antigen-, A antigen- and B antigen-specific).
  • Cellular localization

    Cell membrane. Appears to be colocalized with SLC4A1.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab219896 stained overnight with Coomassie Blue.

References

ab219896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up