Description

  • Product name

    Recombinant Mouse GPA33 protein
    See all GPA33 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVT WNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSL MSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSP QYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIES CNITVAPRPPSMNI
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      22 to 235
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain. NP_067623.1.

Specifications

Our Abpromise guarantee covers the use of ab182694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Reconstitute for long term storage.

    pH: 7.40
    Constituents: 5% Trehalose, 95% PBS

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • A33
    • Cell surface A33 antigen
    • Cell surface A33 antigen precursor
    • Glycoprotein A33
    • Glycoprotein A33 (transmembrane)
    • Gpa33
    • GPA33_HUMAN
    • MGC129986
    • MGC129987
    • OTTHUMP00000032346
    • Transmembrane glycoprotein A33
    see all
  • Function

    May play a role in cell-cell recognition and signaling.
  • Tissue specificity

    Expressed in normal gastrointestinal epithelium and in 95% of colon cancers.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylated, contains approximately 8 kDa of N-linked carbohydrate.
    Palmitoylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab182694 stained overnight with Coomassie Blue.

References

ab182694 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up