Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMAVVASELRCQCLNTLPRVDFETIQS LTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
    • Molecular weight

      11 kDa including tags
    • Amino acids

      28 to 100
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab130034 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab130034 was purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.08% DTT, 0.32% Tris HCl, 50% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • C-X-C motif chemokine 3
    • C-X-C motif chemokine ligand 3
    • Chemokine (C X C motif) ligand 3
    • Chemokine (CXC motif) ligand 3
    • Cinc 2
    • CINC 2b
    • Cinc2
    • CINC2b
    • CXCL 3
    • Cxcl3
    • CXCL3_HUMAN
    • Cytokine induced neutrophil chemoattractant 2
    • Dcip1
    • Dendritic cell inflammatory protein 1
    • Gm1960
    • GRO protein gamma
    • GRO-gamma
    • GRO-gamma(1-73)
    • GRO-gamma(5-73)
    • GRO3
    • GRO3 oncogene
    • GROG
    • Growth regulated protein gamma
    • Growth-regulated protein gamma
    • Macrophage inflammatory protein 2 beta precursor
    • Macrophage inflammatory protein 2-beta
    • Melanoma growth stimulatory activity gamma
    • Member 3
    • MGSA gamma
    • MIP 2b
    • MIP2-beta
    • MIP2B
    • SCYB3
    • Small inducible cytokine subfamily B
    see all
  • Function

    Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    N-terminal processed form GRO-gamma(5-73) is produced by proteolytic cleavage after secretion from peripheral blood monocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab130034 at 3 µg analysed by 15% SDS-PAGE.

References

ab130034 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab130034.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up