Description

  • Product name

    Recombinant mouse GRO gamma protein
    See all GRO gamma proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEV CLNPQGPRLQIIIKKILKSGKSS
    • Predicted molecular weight

      8 kDa
    • Amino acids

      28 to 100
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab203719 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • C-X-C motif chemokine 3
    • C-X-C motif chemokine ligand 3
    • Chemokine (C X C motif) ligand 3
    • Chemokine (CXC motif) ligand 3
    • Cinc 2
    • CINC 2b
    • Cinc2
    • CINC2b
    • CXCL 3
    • Cxcl3
    • CXCL3_HUMAN
    • Cytokine induced neutrophil chemoattractant 2
    • Dcip1
    • Dendritic cell inflammatory protein 1
    • Gm1960
    • GRO protein gamma
    • GRO-gamma
    • GRO-gamma(1-73)
    • GRO-gamma(5-73)
    • GRO3
    • GRO3 oncogene
    • GROG
    • Growth regulated protein gamma
    • Growth-regulated protein gamma
    • Macrophage inflammatory protein 2 beta precursor
    • Macrophage inflammatory protein 2-beta
    • Melanoma growth stimulatory activity gamma
    • Member 3
    • MGSA gamma
    • MIP 2b
    • MIP2-beta
    • MIP2B
    • SCYB3
    • Small inducible cytokine subfamily B
    see all
  • Function

    Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    N-terminal processed form GRO-gamma(5-73) is produced by proteolytic cleavage after secretion from peripheral blood monocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab203719 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203719.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up