Description

  • Product name

    Recombinant Mouse GST3 / GST pi protein
    See all GST3 / GST pi proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab206784 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMPPYTIVYFPVRGRCEAMRMLLADQGQ SWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGDLTLYQSNAILRHLGRSL GLYGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKNDYVKALPGHL KPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLL SAYVARLSARPKIKAFLSSPEHVNRPINGNGKQ
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      1 to 210
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab206784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • Deafness
    • Deafness X-linked 7
    • DFN7
    • FAEES3
    • Fatty Acid Ethyl Ester Synthase III
    • Glutathione S Transferase 3
    • Glutathione S Transferase Pi
    • Glutathione S-transferase P
    • Glutathione S-transferase pi 1
    • GST class-pi
    • GST3
    • GSTP
    • Gstp1
    • GSTP1-1
    • GSTP1_HUMAN
    • PI
    • X linked 7
    see all
  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
  • Sequence similarities

    Belongs to the GST superfamily. Pi family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg of ab206784.

References

ab206784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up