Recombinant Mouse Gstp2 protein (His tag) (ab224636)

Overview

  • Product name

    Recombinant Mouse Gstp2 protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMPPYTIVYFPSPGRCEAMRMLLADQGQ SWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGDLTLYQSNAILRHLGRSL GLYGKNQREAAQVDMVNDGVEDLRGKYGTMIYRNYENGKNDYVKALPGHL KPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLL SAYVARLSARPKIKAFLSSPEHVNRPINGNGKQ
    • Molecular weight

      26 kDa including tags
    • Amino acids

      1 to 210
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_861461.

Specifications

Our Abpromise guarantee covers the use of ab224636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.
    ab224636 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • Glutathione S transferase pi 2
    • Glutathione S-transferase P 2
    • Gst 3
    • GST class-pi
    • Gst P2
    • GST YF-YF
    • GST-piA
    • Gst3
    • Gstp2
    • GSTP2_MOUSE
    see all
  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Cannot metabolize 1-chloro-2,4-dinitrobenzene.
  • Tissue specificity

    Selectively expressed in gall bladder, colon, heart, and skeletal muscle.
  • Sequence similarities

    Belongs to the GST superfamily. Pi family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab224636.

References

ab224636 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up