Description

  • Product name

    Recombinant Mouse HMGCR protein (His tag)
    See all HMGCR proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      GRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYN AHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSI EIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGE LSLMAALAAGH
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      700 to 860
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 3 hydroxy 3 methylglutaryl CoA reductase
    • 3 hydroxy 3 methylglutaryl Coenzyme A reductase
    • 3 hydroxymethylglutaryl CoA reductase
    • 3-hydroxy-3-methylglutaryl CoA reductase (NADPH)
    • 3-hydroxy-3-methylglutaryl-coenzyme A reductase
    • 3H3M
    • HMDH_HUMAN
    • HMG CoA reductase
    • HMG CoAR
    • HMG-CoA reductase
    • Hmgcr
    • Hydroxymethylglutaryl CoA reductase
    • LDLCQ3
    • MGC103269
    • Red
    see all
  • Function

    This transmembrane glycoprotein is involved in the control of cholesterol biosynthesis. It is the rate-limiting enzyme of sterol biosynthesis.
  • Pathway

    Metabolic intermediate biosynthesis; (R)-mevalonate biosynthesis; (R)-mevalonate from acetyl-CoA: step 3/3.
  • Sequence similarities

    Belongs to the HMG-CoA reductase family.
  • Cellular localization

    Endoplasmic reticulum membrane. Peroxisome membrane.
  • Information by UniProt

Images

  • (Tris-glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab235715.

References

ab235715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up