Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSG GCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
    • Molecular weight
      38 kDa
    • Amino acids
      22 to 116

Associated products

Specifications

Our Abpromise guarantee covers the use of ab9898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Endotoxin level
    < 0.100 Eu/µg
  • Form
    Lyophilised
  • Additional notes
    The biological activity of this product was determined by its ability to chemoattract Balb/c mouse spleen MNCs using a concentration of 10-100ng/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Hmeobox protein Hox C10
    • Homeobox Protein Hox C10
    • Homeobox protein Hox-3I
    • Homeobox protein Hox-C10
    • Homeoprotein C10
    • Hox-3.6
    • HOX3I
    • HOXC10
    • HXC10_HUMAN
    • MGC5259
    see all
  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similarities
    Belongs to the Abd-B homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

References

ab9898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for your enquiry.

The recombinant MurineCCL6 (C10) is also in our catalogue ab9898. This is the mature protein, which contains 95 amino acids (amino acids 22-116).

The amino acid sequence is as follows:

GLIQEIEKED RRYNPPIIHQ GFQDTSSDCC FSYATQIPCK RFIYYFPTSG GCIKPGIIFI SRRGTQVCAD PSDRRVQRCL STLKQGPRSG NKVIA

The 21 amino acid N-terminal signal peptide is not present on the protein.

I hope this helps and if I can assist further, please do not hesitate to contact me.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up