Description

  • Product name

    Recombinant Mouse HPD protein (His tag)
    See all HPD proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMTTYNNKGPKPERGRFLHFHSVTFWVG NAKQAASFYCNKMGFEPLAYRGLETGSREVVSHVIKQGKIVFVLCSALNP WNKEMGDHLVKHGDGVKDIAFEVEDCDHIVQKARERGAKIVREPWVEQDK FGKVKFAVLQTYGDTTHTLVEKINYTGRFLPGFEAPTYKDTLLPKLPRCN LEIIDHIVGNQPDQEMQSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSI VVTNYEESIKMPINEPAPGRKKSQIQEYVDYNGGAGVQHIALKTEDIITA IRHLRERGTEFLAAPSSYYKLLRENLKSAKIQVKESMDVLEELHILVDYD EKGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFGAGNFNSLFKAFEEEQAL RGNLTDLEPNGVRSGM
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      1 to 393
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_032303

Specifications

Our Abpromise guarantee covers the use of ab233599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • 4 HPPD
    • 4 hydroxyphenylpyruvate dioxygenase
    • 4 hydroxyphenylpyruvic acid oxidase
    • 4-hydroxyphenylpyruvate dioxygenase
    • 4-hydroxyphenylpyruvic acid oxidase
    • 4HPPD
    • GLOD3
    • glyoxalase domain containing 3
    • HPD
    • HPPD_HUMAN
    • HPPDase
    • PPD
    see all
  • Function

    Key enzyme in the degradation of tyrosine.
  • Pathway

    Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 3/6.
  • Involvement in disease

    Tyrosinemia 3
    Hawkinsinuria
  • Sequence similarities

    Belongs to the 4HPPD family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab233599.

References

ab233599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up