Recombinant mouse ICAM1 protein (Fc Chimera Active) (ab214983)

Description

  • Product name

    Recombinant mouse ICAM1 protein (Fc Chimera Active)
    See all ICAM1 proteins and peptides
  • Biological activity

    Shows the biological function of the CD54 moiety and exerts a prolonged circulating half-life caused by the modified Fc domain.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      QVSIHPREAFLPQGGSVQVNCSSSCKEDLSLGLETQWLKDELESGPNWKL FELSEIGEDSSPLCFENCGTVQSSASATITAYSFPERVELRPLPAWQQVG KDLTLRCHVDGGAPRTQLSAVLLRGEEILSRQPVGGHPKDPKEITFTVLA SRGDHGANFSCRTELDLRPQGLALFSNVSEARRLRTFDLPATIPKLDTPD LLEVGTQQKLFCSLEGLFPASEARIYLELGGQMPTQESTNSSDSVSATAL VEVTEEFDRTLPLRCVLELADQILETQRTLTVYNFSAPVLTLSQLEVSEG SQVTVKCEAHSGSKVVLLSGVEPGPPTPQVQFTLNASSEDHKRRFFCSAA LEVAGKFLSKNQTLELHVLYGPRLDETDCLGNWTWQEGSQQTLKCQAWGN PSPKMTCRRKADGALLPIGVVKSVKQEMNGTYVCHAFSSHGNVTRNVYLT VLYHSQNN
    • Amino acids

      28 to 485
    • Additional sequence information

      Extracellular domain fused to the N-terminus of the Fc region of a mutant mouse IgG2a.

Specifications

Our Abpromise guarantee covers the use of ab214983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Non-lytic: Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcgR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute at 100 µg/mL in sterile PBS. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • Antigen identified by monoclonal antibody BB2
    • BB 2
    • BB2
    • CD 54
    • CD_antigen=CD54
    • CD54
    • Cell surface glycoprotein P3.58
    • Human rhinovirus receptor
    • ICAM 1
    • ICAM-1
    • ICAM1
    • ICAM1_HUMAN
    • Intercellular adhesion molecule 1
    • intercellular adhesion molecule 1 (CD54)
    • intercellular adhesion molecule 1 (CD54), human rhinovirus receptor
    • Major group rhinovirus receptor
    • MALA 2
    • MALA2
    • MyD 10
    • MyD10
    • P3.58
    • Surface antigen of activated B cells
    • Surface antigen of activated B cells, BB2
    see all
  • Function

    ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. In case of rhinovirus infection acts as a cellular receptor for the virus.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. ICAM family.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab214983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up