Recombinant mouse ICOS Ligand/ICOSL protein (Active) (ab214990)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level: < 0.060 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant mouse ICOS Ligand/ICOSL protein (Active)
See all ICOS Ligand/ICOSL proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized human ICOS at 1μg/ml (100μl/well) can bind biotinylated B7-H2 (mouse):Fc (mouse) (rec.) (non-lytic) with a linear range of 0.1-1.0μg/ml. Optimal dilutions should be determined by each laboratory for each application.
Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcγR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
< 0.060 Eu/µg -
Expression system
CHO cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
TEVGAMVGSNVVLSCIDPHRRHFNLSGLYVYWQIENPEVSVTYYLPYKSP GINVDSSYKNRGHLSLDSMKQGNFSLYLKNVTPQDTQEFTCRVFMNTATE LVKILEEVVRLRVAANFSTPVISTSDSSNPGQERTYTCMSKNGYPEPNLY WINTTDNSLIDTALQNNTVYLNKLGLYDVISTLRLPWTSRGDVLCCVENV ALHQNITSISQAESFTGNNTKNPQETHNNELK -
Amino acids
48 to 279 -
Additional sequence information
Extracellular domain fused to the N-terminus of the Fc region of a mutant mouse IgG2a.
-
Specifications
Our Abpromise guarantee covers the use of ab214990 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
This product was previously labelled as ICOS Ligand
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: 100% PBS
Lyophilized from 0.2µm-filtered solutionThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute at 100µg/ml in sterile PBS.
General Info
-
Alternative names
- B7 H2
- B7 homolog 2
- B7 homologue 2
see all -
Function
Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. -
Tissue specificity
Isoform 1 is widely expressed (brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, bone marrow, colon, ovary, prostate, testis, lymph nodes, leukocytes, spleen, thymus and tonsil), while isoform 2 is detected only in lymph nodes, leukocytes and spleen. Expressed on activated monocytes and dendritic cells. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab214990 has not yet been referenced specifically in any publications.