Recombinant Mouse ICOS Ligand/ICOSL protein (Fc Chimera) (ab215004)

Description

  • Product name

    Recombinant Mouse ICOS Ligand/ICOSL protein (Fc Chimera)
    See all ICOS Ligand/ICOSL proteins and peptides
  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      TEVGAMVGSNVVLSCIDPHRRHFNLSGLYVYWQIENPEVSVTYYLPYKSP GINVDSSYKNRGHLSLDSMKQGNFSLYLKNVTPQDTQEFTCRVFMNTATE LVKILEEVVRLRVAANFSTPVISTSDSSNPGQE RTYTCMSKNGYPEPN LYWINTTDNSLIDTALQNNTVYLNKLGLYDVISTLRLPWTSRGDVLCCVE NVALHQNITSISQAESFTGNNTKNPQETHNNEL
    • Amino acids

      48 to 279
    • Additional sequence information

      Extracellular domain fused to the N terminus of the Fc region of mouse IgG2a.

Specifications

Our Abpromise guarantee covers the use of ab215004 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as ICOS Ligand

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilized from 0.2 µm filtered solution.

  • Reconstitution
    Reconstitute at 100 µg/mL in sterile PBS. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • B7 H2
    • B7 homolog 2
    • B7 homologue 2
    • B7 like protein Gl50
    • B7 related protein 1
    • B7-H2
    • B7-like protein Gl50
    • B7-related protein 1
    • B7H2
    • B7RP 1
    • B7RP-1
    • B7RP1
    • CD 275
    • CD275
    • CD275 antigen
    • GL 50
    • GL50
    • ICOS L
    • ICOS LG
    • ICOS ligand
    • ICOSL
    • ICOSL_HUMAN
    • Icoslg
    • Inducible T cell co stimulator ligand
    • KIAA0653
    • LICOS
    • Transmembrane protein B7 H2 ICOS ligand
    see all
  • Function

    Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function.
  • Tissue specificity

    Isoform 1 is widely expressed (brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, bone marrow, colon, ovary, prostate, testis, lymph nodes, leukocytes, spleen, thymus and tonsil), while isoform 2 is detected only in lymph nodes, leukocytes and spleen. Expressed on activated monocytes and dendritic cells.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215004 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215004.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up