Description

  • Product name

    Recombinant mouse IGF2 protein (Active)
    See all IGF2 proteins and peptides
  • Biological activity

    FDC-P1 cell proliferation. ED50 ≤ 50 ng/mL (≥ 2.0 x 104 units/mg)

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRS CDLALLETYCATPAKSE
    • Predicted molecular weight

      7 kDa
    • Amino acids

      25 to 91
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 91. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab233678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilized from a sterile (0.2 micron) filtered aqueous solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • C11orf43
    • IGF 2
    • IGF II
    • IGF-II
    • IGF2
    • IGF2_HUMAN
    • IGFII
    • INSIGF
    • Insulin like Growth Factor 2
    • insulin like growth factor 2 (somatomedin A)
    • Insulin like growth factor II
    • Insulin like growth factor II precursor
    • Insulin like growth factor type 2
    • pp9974
    • Preptin
    • putative insulin like growth factor II associated protein
    • Somatomedin A
    • Somatomedin-A
    see all
  • Function

    The insulin-like growth factors possess growth-promoting activity. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development.
    Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.
  • Involvement in disease

    Epigenetic changes of DNA hypomethylation in IGF2 are a cause of Silver-Russell syndrome (SIRS) [MIM:180860]. SIRS is a clinically heterogeneous condition characterized by severe intrauterine growth retardation, poor postnatal growth, craniofacial features such as a triangular shaped face and a broad forehead, body asymmetry, and a variety of minor malformations.
  • Sequence similarities

    Belongs to the insulin family.
  • Post-translational
    modifications

    O-glycosylated with a core 1 or possibly core 8 glycan.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 1 µg ab233678 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

  • ab233678 induced proliferation of FDC-P1 cells.

References

ab233678 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233678.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up