Description

  • Product name

    Recombinant Mouse IgG1 protein
    See all IgG1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      VPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVE VHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIE KTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQW NGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLH NHHTEKSLSHSPGK
    • Predicted molecular weight

      24 kDa
    • Amino acids

      111 to 324
    • Additional sequence information

      The fragment corresponds to the CH2 and CH3 domains. Genbank entry: AAK53870.1.

Specifications

Our Abpromise guarantee covers the use of ab180055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.50
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine, L-Arginine, Sodium chloride

    Lyophilized from 0.22 µm filtered solution.

General Info

  • Alternative names

    • Ig gamma 1 chain C region
    • IgG heavy chain locus
    • IGHG1
    • Immunoglobulin Gm1
    • Immunoglobulin heavy constant gamma 1 (G1m marker)
    see all
  • Relevance

    There are four IgG subclasses (IgG1, 2, 3 and 4) in humans, named in order of their abundance in serum (IgG1 being the most abundant).
  • Cellular localization

    Secreted. Cell membrane; Single-pass membrane protein

Images

  • SDS-PAGE analysis of ab180055 under reducing conditions. Gel stained overnight with Coomassie Blue. The protein has a calculated MW of 24.3 kDa. The reduced protein migrates as 28-30 kDa due to glycosylation.

References

ab180055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up