Description

  • Product name

    Recombinant Mouse IGJ protein (His tag)
    See all IGJ proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      GDDEATILADNKCMCTRVTSRIIPSTEDPNEDIVERNIRIVVPLNNRENI SDPTSPLRRNFVYHLSDVCKKCDPVEVELEDQVVTATQSNICNEDDGVPE TCYMYDRNKCYTTMVPLRYHGETKMVQAALTPDSCYPD
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      22 to 159
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 22 to 159. The signal peptide is not included. N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab235555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • IGCJ
    • IGJ_HUMAN
    • Immunoglobulin J chain
    • Immunoglobulin J polypeptide linker protein for immunoglobulin alpha and mu polypeptides
    • immunoglobulin joining chain
    • JCH
    • JCHAIN
    • Joining chain of multimeric IgA and IgM
    see all
  • Function

    Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to secretory component.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235555.

References

ab235555 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up