Description

  • Product name

    Recombinant Mouse IGJ protein (His tag)
    See all IGJ proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      GDDEATILADNKCMCTRVTSRIIPSTEDPNEDIVERNIRIVVPLNNRENI SDPTSPLRRNFVYHLSDVCKKCDPVEVELEDQVVTATQSNICNEDDGVPE TCYMYDRNKCYTTMVPLRYHGETKMVQAALTPDSCYPD
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      22 to 159
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 22 to 159. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab240834 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • IGCJ
    • IGJ_HUMAN
    • Immunoglobulin J chain
    • Immunoglobulin J polypeptide linker protein for immunoglobulin alpha and mu polypeptides
    • immunoglobulin joining chain
    • JCH
    • JCHAIN
    • Joining chain of multimeric IgA and IgM
    see all
  • Function

    Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to secretory component.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab240834.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab240834 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) IGJ.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab240834 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) IGJ.

References

ab240834 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab240834.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up