Description

  • Product name

    Recombinant mouse Ihh protein (Animal Free)
    See all Ihh proteins and peptides
  • Biological activity

    The activity is determined by the dose-dependent induction of alkaline phosphatase acitivity of CCL-226 cells and is typically less than 10 µg/mL. This corresponds to an expected specific activity of 1 x 102 units/mg.

  • Purity

    > 97 % SDS-PAGE.
    Purity is typically 97% as determined by reducing and non-reducing SDS-PAGE.
  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MIIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSS ERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGV KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGF DWVYYESKAHVHCSVKSEHSAAAKTGG
    • Predicted molecular weight

      20 kDa
    • Amino acids

      29 to 202

Specifications

Our Abpromise guarantee covers the use of ab205517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    This product shares 100% homology with amino acids 29 -202 of Human IHH.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Suspend the product by gently pipetting 250 ul of 10mM HCl down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution.

General Info

  • Alternative names

    • BDA1
    • HHG-2
    • HHG2
    • IHH
    • IHH_HUMAN
    • Indian Hedgehog
    • Indian hedgehog homolog
    • Indian hedgehog protein
    • Indian hedgehog protein C-product
    • Indian hedgehog protein N-product
    see all
  • Function

    Intercellular signal essential for a variety of patterning events during development. Binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. Implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones. Induces the expression of parathyroid hormone-related protein (PTHRP).
  • Tissue specificity

    Expressed in embryonic lung, and in adult kidney and liver.
  • Involvement in disease

    Defects in IHH are the cause of brachydactyly type A1 (BDA1) [MIM:112500]. BDA1 is an autosomal dominant disorder characterized by middle phalanges of all the digits rudimentary or fused with the terminal phalanges. The proximal phalanges of the thumbs and big toes are short.
    Defects in IHH are a cause of acrocapitofemoral dysplasia (ACFD) [MIM:607778]. ACFD is a disorder characterized by short stature of variable severity with postnatal onset. The most constant radiographic abnormalities are observed in the tubular bones of the hands and in the proximal part of the femur. Cone-shaped epiphyses or a similar epiphyseal configuration with premature epimetaphyseal fusion result in shortening of the skeletal components involved. Cone-shaped epiphyses were also present to a variable extent at the shoulders, knees, and ankles.
  • Sequence similarities

    Belongs to the hedgehog family.
  • Post-translational
    modifications

    The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-terminal fragment (N-product). The N-product is the active species in both local and long-range signaling, whereas the C-product has no signaling activity.
    Cholesterylation is required for N-product targeting to lipid rafts and multimerization.
    Palmitoylated. N-palmitoylation is required for N-product multimerization and full activity.
  • Cellular localization

    Secreted > extracellular space. The C-terminal peptide diffuses from the cell and Cell membrane. The N-terminal peptide remains associated with the cell surface.
  • Information by UniProt

Images

  •  SDS PAGE analysis of ab205517 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.

References

ab205517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up