Overview

Description

  • Nature

    Recombinant
  • Source

    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MPGSALLCCLLLLTGMRISRGQYSREDNNCTHFPVGQSHMLLELRTAFSQ VKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEK HGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQ DQGVYKAMNEFDIFINCIEAYMMIKMKS
    • Amino acids

      1 to 178
    • Additional sequence information

      Full lenght protein fused to the N-terminus of the Fc region of a mutant mouse IgG2a.

Specifications

Our Abpromise guarantee covers the use of ab214989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Shows the biological function of the IL-10 moiety and exerts a prolonged circulating half-life caused by the modified Fc domain. Measured 50% inhibition of LPS-induced IL-6 production by PU5-1 cells.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 0.060 Eu/µg
  • Purity

    >= 98 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

    Non-lytic: Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcgR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilized from 0.2µm-filtered solution

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute at 100µg/ml in sterile PBS.

General Info

  • Alternative names

    • CSIF
    • Cytokine synthesis inhibitory factor
    • GVHDS
    • IL 10
    • IL-10
    • IL10
    • IL10_HUMAN
    • IL10A
    • Interleukin 10
    • Interleukin-10
    • MGC126450
    • MGC126451
    • T-cell growth inhibitory factor
    • TGIF
    see all
  • Function

    Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
  • Tissue specificity

    Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.
  • Sequence similarities

    Belongs to the IL-10 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab214989 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up