Description

  • Product name

    Recombinant mouse IL-10 protein (Active)
    See all IL-10 proteins and peptides
  • Biological activity

    MC/9 cell proliferation: ED50 of ≤5 ng/mL;  ≥2.0 x 105 units/mg (typical ED50 range is ≤2 ng/mL; 5.0 x 105 units/mg)

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLT DSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLK TLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINC IEAYMMIKMKS
    • Predicted molecular weight

      19 kDa
    • Amino acids

      19 to 178
    • Additional sequence information

      This product is the mature full length protein from aa 19 to 178. The signal peptide is not included. Non-covalent homodimer.

Specifications

Our Abpromise guarantee covers the use of ab222176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    Lyophilized from a sterile 0.2 micron filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.

General Info

  • Alternative names

    • CSIF
    • Cytokine synthesis inhibitory factor
    • GVHDS
    • IL 10
    • IL-10
    • IL10
    • IL10_HUMAN
    • IL10A
    • Interleukin 10
    • Interleukin-10
    • MGC126450
    • MGC126451
    • T-cell growth inhibitory factor
    • TGIF
    see all
  • Function

    Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
  • Tissue specificity

    Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.
  • Sequence similarities

    Belongs to the IL-10 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Functional analysis of ab222176
  • 1 µg ab222176 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

    ab222176 is predicted to be a non-covalently linked homodimer with a molecuar weight of 18.9 kDa for each monomer.

References

ab222176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up