Description

  • Product name

    Recombinant Mouse IL-13 protein
    See all IL-13 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALD SLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSY TKQLFRHGPFVDHHHHHH
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      22 to 131
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 3X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml. After reconstitution aliquot and store at < -20 degrees, avoid freeze/thaw cycles.

General Info

  • Alternative names

    • Allergic rhinitis
    • ALRH
    • BHR 1
    • BHR1
    • Bronchial hyperresponsiveness 1 (bronchial asthma)
    • IL 13
    • IL-13
    • Il13
    • IL13_HUMAN
    • Interleukin 13
    • Interleukin-13
    • interleukin13
    • MGC116786
    • MGC116788
    • MGC116789
    • NC 30
    • NC30
    • P 600
    • P600
    see all
  • Function

    Cytokine (PubMed:8096327, PubMed:8097324). Inhibits inflammatory cytokine production (PubMed:8096327). Synergizes with IL2 in regulating interferon-gamma synthesis (PubMed:8096327). May be critical in regulating inflammatory and immune responses (PubMed:8096327, PubMed:8097324). Positively regulates IL31RA expression in macrophages.
  • Involvement in disease

    Allergic rhinitis
  • Sequence similarities

    Belongs to the IL-4/IL-13 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab185392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up