Recombinant Mouse IL-13 receptor alpha 1 protein (His tag) (ab221405)

Description

  • Product name

    Recombinant Mouse IL-13 receptor alpha 1 protein (His tag)
    See all IL-13 receptor alpha 1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ATEVQPPVTNLSVSVENLCTIIWTWSPPEGASPNCTLRYFSHFDDQQDKK IAPETHRKEELPLDEKICLQVGSQCSANESEKPSPLVKKCISPPEGDPES AVTELKCIWHNLSYMKCSWLPGRNTSPDTHYTLYYWYSSLEKSRQCENIY REGQHIACSFKLTKVEPSFEHQNVQIMVKDNAGKIRPSCKIVSLTSYVKP DPPHIKHLLLKNGALLVQWKNPQNFRSRCLTYEVEVNNTQTDRHNILEVE EDKCQNSESDRNMEGTSCFQLPGVLADAVYTVRVRVKTNKLCFDDNKLWS DWSEAQSIGKEQNST
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      26 to 340
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab221405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • bB128O4.2.1 (interleukin 13 receptor, alpha 1)
    • Cancer/testis antigen 19
    • CD213a1
    • CD213A1 Antigen
    • CT 19
    • CT19
    • I13R1_HUMAN
    • IL 13 receptor subunit alpha 1
    • IL 13R alpha 1
    • IL 13R subunit alpha 1
    • IL 13Ra
    • IL 13RA1
    • IL-13 receptor subunit alpha-1
    • IL-13R subunit alpha-1
    • IL-13R-alpha-1
    • IL-13RA1
    • IL13 receptor alpha 1 chain
    • IL13R
    • IL13RA
    • Il13ra1
    • Interleukin 13 receptor alpha 1
    • Interleukin 13 receptor alpha 1 chain
    • interleukin 13 receptor subunit alpha 1
    • Interleukin-13 receptor subunit alpha-1
    • NR 4
    • NR4
    see all
  • Function

    Binds with low affinity to interleukin-13 (IL13). Together with IL4RA can form a functional receptor for IL13. Also serves as an alternate accessory protein to the common cytokine receptor gamma chain for interleukin-4 (IL4) signaling, but cannot replace the function of IL2RG in allowing enhanced interleukin-2 (IL2) binding activity.
  • Tissue specificity

    Ubiquitous. Highest levels in heart, liver, skeletal muscle and ovary; lowest levels in brain, lung and kidney. Also found in B-cells, T-cells and endothelial cells.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 5 subfamily.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE using ab221405. The reducing protein migrates as 50-60 kDa due to glycosylation.

References

ab221405 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up