Recombinant mouse IL-16 protein (Active) (ab256040)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant mouse IL-16 protein (Active)
See all IL-16 proteins and peptides -
Biological activity
Primary human T cell chemotaxis (first detectable at 5 ng/mL).
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
MHDLNSSTDSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKG SLHGDKPLTINRIFKGDRTGEMVQPGDEILQLAGTAVQGLTRFEAWNVIK ALPDGPVTIVIRRTSLQCKQTTASADS -
Predicted molecular weight
13 kDa -
Amino acids
1197 to 1322
-
Associated products
Specifications
Our Abpromise guarantee covers the use of ab256040 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at room temperature. Store at -20°C.
Constituent: 0.16% Sodium phosphate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in sterile water to 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
General Info
-
Alternative names
- HGNC:5980
- HsT19289
- IL-16
see all -
Function
Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4.
Isoform 1 may act as a scaffolding protein that anchors ion channels in the membrane.
Isoform 3 is involved in cell cycle progression in T-cells. Appears to be involved in transcriptional regulation of SKP2 and is probably part of a transcriptional repression complex on the core promoter of the SKP2 gene. May act as a scaffold for GABPB1 (the DNA-binding subunit the GABP transcription factor complex) and HDAC3 thus maintaining transcriptional repression and blocking cell cycle progression in resting T-cells. -
Tissue specificity
Isoform 3 is expressed in hemopoietic tissues, such as resting T-cells, but is undetectable during active T cell proliferation. -
Sequence similarities
Contains 4 PDZ (DHR) domains. -
Post-translational
modificationsIsoform 3 is synthesized as a chemo-attractant inactive precursor in hemopoietic tissues and is proteolytically cleaved by caspase-3 to yield IL-16. -
Cellular localization
Cytoplasm; Cytoplasm. Nucleus and Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab256040 has not yet been referenced specifically in any publications.