Description

  • Product name

    Recombinant Mouse IL-16 protein (His tag)
    See all IL-16 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSAASASAASDISVESKEATVCTVTLEKTS AGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQ GLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      1205 to 1322
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab215602 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.87% Sodium chloride

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml.

General Info

  • Alternative names

    • HGNC:5980
    • HsT19289
    • IL-16
    • IL16
    • IL16_HUMAN
    • Interleukin 16 precursor
    • Interleukin-16
    • LCF
    • Lymphocyte chemoattractant factor
    • Neuronal interleukin 16
    • NIL16
    • prIL 16
    • PrIL16
    • Prointerleukin 16
    see all
  • Function

    Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4.
    Isoform 1 may act as a scaffolding protein that anchors ion channels in the membrane.
    Isoform 3 is involved in cell cycle progression in T-cells. Appears to be involved in transcriptional regulation of SKP2 and is probably part of a transcriptional repression complex on the core promoter of the SKP2 gene. May act as a scaffold for GABPB1 (the DNA-binding subunit the GABP transcription factor complex) and HDAC3 thus maintaining transcriptional repression and blocking cell cycle progression in resting T-cells.
  • Tissue specificity

    Isoform 3 is expressed in hemopoietic tissues, such as resting T-cells, but is undetectable during active T cell proliferation.
  • Sequence similarities

    Contains 4 PDZ (DHR) domains.
  • Post-translational
    modifications

    Isoform 3 is synthesized as a chemo-attractant inactive precursor in hemopoietic tissues and is proteolytically cleaved by caspase-3 to yield IL-16.
  • Cellular localization

    Cytoplasm; Cytoplasm. Nucleus and Secreted.
  • Information by UniProt

References

ab215602 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215602.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up