Description

  • Product name

    Recombinant Mouse IL-19 protein (Animal Free)
    See all IL-19 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab207978 was determined by reducing and non-reducing SDS-PAGE.
  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDV CCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVH RQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLET PAA
    • Predicted molecular weight

      18 kDa
    • Amino acids

      25 to 176
    • Additional sequence information

      Mature form without initial signal peptode, but with an additional Met.

Specifications

Our Abpromise guarantee covers the use of ab207978 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.87% Sodium chloride, 0.08% Sodium phosphate

    Lyophilized from a sterile filtered aqueous solution.

  • Reconstitution
    Reconstitute in sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 ºC and avoid repeat freeze thaws.

General Info

  • Alternative names

    • IL 10C
    • IL 19
    • IL-19
    • Il19
    • IL19_HUMAN
    • Interleukin 19
    • Interleukin-19
    • MDA1
    • Melanoma differentiation-associated protein-like protein
    • NG.1
    • ZMDA1
    see all
  • Function

    May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis.
  • Sequence similarities

    Belongs to the IL-10 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab207978 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207978.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up