Description

  • Product name

    Recombinant Mouse IL-1R-2 protein (Fc Chimera)
    See all IL-1R-2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      FTTPTVVHTGKVSESPITSEKPTVHGDNCQFRGREFKSELRLEGEPVVLR CPLAPHSDISSSSHSFLTWSKLDSSQLIPRDEPRMWVKGNILWILPAVQQ DSGTYICTFRNASHCEQMSVELKVFKNTEASLPHVSYLQISALSTTGLLV CPDLKEFISSNADGKIQWYKGAILLDKGNKEFLSAGDPTRLLISNTSMDD AGYYRCVMTFTYNGQEYNITRNIELRVKGTTTEPIPVIISPLETIPASLG SRLIVPCKVFLGTGTSSNTIVWWLANSTFISAAYPRGRVTEGLHHQYSEN DENYVEVSLIFDPVTREDLHTDFKCVASNPRSSQSLHTTVKEIEGRDMDP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      14 to 355
    • Additional sequence information

      Extracellular domain. Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab215605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as IL1 Receptor II.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml.

General Info

  • Alternative names

    • IL1 Receptor II
    • Antigen CDw121b
    • CD121
    • CD121 antigen-like family member B
    • CD121b
    • CD121B Antigen
    • CDw121b
    • IL 1 type II receptor
    • IL-1R-2
    • IL-1R-beta
    • IL-1R2
    • IL-1RT-2
    • IL-1RT2
    • IL1R Beta
    • Il1r-2
    • IL1R2
    • IL1R2_HUMAN
    • IL1R2c
    • IL1RB
    • Interleukin 1 receptor type II variant 3
    • Interleukin 1 receptor, beta, type II
    • Interleukin 1 receptor, type II
    • Interleukin-1 receptor beta
    • Interleukin-1 receptor type 2
    • Interleukin-1 receptor type II
    • MGC137383
    • MGC47725
    • OTTHUMP00000207969
    • p68
    • Type II interleukin-1 receptor, beta
    see all
  • Function

    Receptor for interleukin-1 alpha (IL-1A), beta (IL-1B), and interleukin-1 receptor antagonist protein (IL-1ra).
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215605 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up