Description

  • Product name

    Recombinant mouse IL-2 protein (Active)
    See all IL-2 proteins and peptides
  • Biological activity

    Biological activity: Measured in a cell proliferation assay using CTLL-2 mouse T lymphocyte. The ED50 for this effect is < 0.9 ng/ml.

  • Purity

    > 90 % SDS-PAGE.
    ab202264 was purified using conventional chromatography.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MAPTSSSTSS STAEAQQQQQ QQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQATELKD LQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFE CQFDDESATVVDFLRRWIAFSQSIISTSPQ
    • Predicted molecular weight

      17 kDa
    • Amino acids

      21 to 169
    • Additional sequence information

      Mature protein without signal peptide. NCBI Accession No.: NP_032392.

Specifications

Our Abpromise guarantee covers the use of ab202264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Functional Studies

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Concentration of ab202264 was determined by BCA assay. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 90% PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Aldesleukin
    • IL 2
    • IL-2
    • IL2
    • IL2_HUMAN
    • Interleukin 2
    • Interleukin-2
    • interleukin2
    • Involved in regulation of T cell clonal expansion
    • Lymphokine
    • OTTHUMP00000164090
    • POIL2
    • T Cell Growth Factor
    • T-cell growth factor
    • TCGF
    see all
  • Function

    Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
  • Involvement in disease

    Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17.
  • Sequence similarities

    Belongs to the IL-2 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202264 (3 µg)

References

ab202264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up