Description

  • Product name

    Recombinant mouse IL-2 protein (Active)
    See all IL-2 proteins and peptides
  • Biological activity

    CTLL-2 cell proliferation ≤5 ng/mL; ≥ 2.0 x 10^5 units/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLK LPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAEN FISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ
    • Predicted molecular weight

      17 kDa
    • Amino acids

      21 to 169
    • Additional sequence information

      Full length mature chain without signal peptide. Source: Genetically modified E.coli.

Specifications

Our Abpromise guarantee covers the use of ab238291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    12 months from date of receipt when stored at -20°C to -80°C as supplied.
    1 month when stored at 4°C after reconstituting as directed.
    3 months when stored at -20°C to -80°C after reconstituting as directed.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 4.00
    Constituent: 0.29% Sodium citrate

    Lyophilized from a sterile (0.2 micron) filtered aqueous solution

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Sterile 10 mM acetic acid at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • Aldesleukin
    • IL 2
    • IL-2
    • IL2
    • IL2_HUMAN
    • Interleukin 2
    • Interleukin-2
    • interleukin2
    • Involved in regulation of T cell clonal expansion
    • Lymphokine
    • OTTHUMP00000164090
    • POIL2
    • T Cell Growth Factor
    • T-cell growth factor
    • TCGF
    see all
  • Function

    Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
  • Involvement in disease

    Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17.
  • Sequence similarities

    Belongs to the IL-2 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Induced proliferation of CTLL-2 cells (≤5 ng/mL; ≥ 2.0 x 10^5 units/mg).

  • Recombinant mouse IL2 protein (Active) (ab238291) used at 1 µg run under reducing conditions in a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

References

ab238291 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up