Recombinant mouse IL-2 Receptor alpha protein (Active) (ab255798)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant mouse IL-2 Receptor alpha protein (Active)
See all IL-2 Receptor alpha proteins and peptides -
Biological activity
Immobilized biotinylated human IL-2, Fc Tag, Avi Tag at 5 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate, can bind ab255798 with a linear range of 5-40 ng/mL.
Immobilized ab255798 at 5 μg/mL (100 μL/well) can bind biotinylated human IL-2, Fc Tag, Avi Tag with a linear range of 0.6-10 ng/mL.
-
Purity
> 90 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSW SSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHC REPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKT GWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTE TTAMTETFVLTMEYK -
Predicted molecular weight
27 kDa including tags -
Amino acids
22 to 236 -
Tags
His tag C-Terminus -
Additional sequence information
Extracellular domain.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab255798 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilised -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- Interleukin 2 receptor alpha chain
- CD25
- CD25 antigen
see all -
Function
Receptor for interleukin-2. -
Involvement in disease
Genetic variations in IL2RA are associated with susceptibility to diabetes mellitus insulin-dependent type 10 (IDDM10) [MIM:601942]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. -
Sequence similarities
Contains 2 Sushi (CCP/SCR) domains. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant mouse IL-2 Receptor alpha protein (Active) (ab255798)SDS-PAGE - Recombinant mouse IL-2 Receptor alpha protein (Active) (ab255798) under reducing (R) conditions. The gel was stained overnight with Coomassie Blue. The protein migrates as 40-60 kDa under reducing conditions due to glycosylation.
-
Functional Studies - Recombinant mouse IL-2 Receptor alpha protein (Active) (ab255798)Immobilized ab255798 at 5 μg/mL (100 μL/well) can bind biotinylated human IL-2, Fc Tag, Avi Tag with a linear range of 0.6-10 ng/mL.
-
Functional Studies - Recombinant mouse IL-2 Receptor alpha protein (Active) (ab255798)Immobilized biotinylated human IL-2, Fc Tag, Avi Tag at 5 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate, can bind ab255798 with a linear range of 5-40 ng/mL.
Datasheets and documents
References
ab255798 has not yet been referenced specifically in any publications.
