Recombinant mouse IL-2 Receptor alpha protein (Active) (ab255798)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant mouse IL-2 Receptor alpha protein (Active)
See all IL-2 Receptor alpha proteins and peptides -
Biological activity
Immobilized biotinylated human IL-2, Fc Tag, Avi Tag at 5 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate, can bind ab255798 with a linear range of 5-40 ng/mL.
Immobilized ab255798 at 5 μg/mL (100 μL/well) can bind biotinylated human IL-2, Fc Tag, Avi Tag with a linear range of 0.6-10 ng/mL.
-
Purity
> 90 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSW SSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHC REPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKT GWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTE TTAMTETFVLTMEYK -
Predicted molecular weight
27 kDa including tags -
Amino acids
22 to 236 -
Tags
His tag C-Terminus -
Additional sequence information
Extracellular domain.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab255798 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- Interleukin 2 receptor alpha chain
- CD25
- CD25 antigen
see all -
Function
Receptor for interleukin-2. -
Involvement in disease
Genetic variations in IL2RA are associated with susceptibility to diabetes mellitus insulin-dependent type 10 (IDDM10) [MIM:601942]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. -
Sequence similarities
Contains 2 Sushi (CCP/SCR) domains. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant mouse IL-2 Receptor alpha protein (Active) (ab255798) under reducing (R) conditions. The gel was stained overnight with Coomassie Blue. The protein migrates as 40-60 kDa under reducing conditions due to glycosylation.
-
Immobilized ab255798 at 5 μg/mL (100 μL/well) can bind biotinylated human IL-2, Fc Tag, Avi Tag with a linear range of 0.6-10 ng/mL.
-
Immobilized biotinylated human IL-2, Fc Tag, Avi Tag at 5 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate, can bind ab255798 with a linear range of 5-40 ng/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab255798 has not yet been referenced specifically in any publications.