Description

  • Product name

    Recombinant mouse IL-21 protein (Fc Chimera Active)
    See all IL-21 proteins and peptides
  • Biological activity

    Shows the biological function of the IL21 moiety and exerts a prolonged circulating half-life caused by the modified Fc domain. Non-lytic: Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcgR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHA AFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPS CDSYEKRTPKEFLERLKWLLQKVCTLNAF
    • Amino acids

      18 to 146
    • Additional sequence information

      The extracellular domain of mouse IL21 fused to the N terminus of the Fc region of a mutant mouse IgG2a.

Specifications

Our Abpromise guarantee covers the use of ab215000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilized from 0.2 µm-filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute at 100 µg/ml in sterile PBS.

General Info

  • Alternative names

    • CVID11
    • IL 21
    • IL-21
    • Il21
    • IL21_HUMAN
    • Interleukin 21
    • Interleukin-21
    • interleukin-21 isoform
    • Interleukin21
    • OTTHUMP00000164088
    • Za11
    see all
  • Function

    Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
  • Tissue specificity

    Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes.
  • Sequence similarities

    Belongs to the IL-15/IL-21 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab215000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up