Recombinant mouse IL-21R protein (Fc Chimera Active) (ab215030)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level: < 0.060 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant mouse IL-21R protein (Fc Chimera Active)
See all IL-21R proteins and peptides -
Biological activity
Shows the biological function of the IL-21R moiety and exerts a prolonged circulating half-life caused by the modified Fc domain.
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
< 0.060 Eu/µg -
Expression system
CHO cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHR SGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIK PAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAV RPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSD PVIFQTQAGEPEAGW -
Amino acids
20 to 234 -
Additional sequence information
Extracellular domain, fused to the N-terminus of the Fc region of a mutant mouse IgG2a. (AAL82636.1).
-
Specifications
Our Abpromise guarantee covers the use of ab215030 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
Non-lytic: Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcgR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Constituent: PBS
Lyophilized from 0.2 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute vial with 100 µL sterile water. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- CD360
- IL 21R
- IL-21 receptor
see all -
Function
This is a receptor for interleukin-21. -
Tissue specificity
Selectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen. -
Sequence similarities
Belongs to the type I cytokine receptor family. Type 4 subfamily.
Contains 2 fibronectin type-III domains. -
Domain
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation. -
Post-translational
modificationsC-mannosylated at Trp-214 in the WSXWS motif, the sugar chain makes extensive hydrogen bonds with Asn-73 sugar, and bridges the two fibronectin domains transforming the V-shaped receptor into an A-frame. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab215030 has not yet been referenced specifically in any publications.