Overview

Description

  • Nature

    Recombinant
  • Source

    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHR SGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIK PAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAV RPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSD PVIFQTQAGEPEAGW
    • Amino acids

      20 to 234
    • Additional sequence information

      Extracellular domain, fused to the N-terminus of the Fc region of a mutant mouse IgG2a. (AAL82636.1).

Specifications

Our Abpromise guarantee covers the use of ab215030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Shows the biological function of the IL-21R moiety and exerts a prolonged circulating half-life caused by the modified Fc domain.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 0.060 Eu/µg
  • Purity

    >= 98 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

    Non-lytic: Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcgR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute vial with 100 µL sterile water. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • CD360
    • IL 21R
    • IL-21 receptor
    • IL-21R
    • IL21 receptor
    • IL21R
    • IL21R_HUMAN
    • Interleukin 21 receptor
    • Interleukin-21 receptor
    • MGC10967
    • NILR
    • Novel interleukin receptor
    see all
  • Function

    This is a receptor for interleukin-21.
  • Tissue specificity

    Selectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 2 fibronectin type-III domains.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications

    C-mannosylated at Trp-214 in the WSXWS motif, the sugar chain makes extensive hydrogen bonds with Asn-73 sugar, and bridges the two fibronectin domains transforming the V-shaped receptor into an A-frame.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215030 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up