Description

  • Product name

    Recombinant Mouse IL-22 protein (Fc Chimera)
    See all IL-22 proteins and peptides
  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGV SAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCH ISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
    • Predicted molecular weight

      17 kDa
    • Amino acids

      34 to 179
    • Additional sequence information

      This product is the mature full length protein from aa 34 to 179. The signal peptide is not included (NP_058667.1). Fused to the N-terminus of the Fc region of mouse IgG2a.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab214995 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilized from 0.2µm filtered solution.

  • Reconstitution
    Reconstitute at 100µg/ml in sterile PBS.

General Info

  • Alternative names

    • Cytokine Zcyto18
    • IL 10 related T cell derived inducible factor
    • IL 21
    • IL 22
    • IL D110
    • IL TIF
    • IL-10-related T-cell-derived-inducible factor
    • IL-22
    • IL-TIF
    • IL21
    • Il22
    • IL22_HUMAN
    • ILD110
    • ILTIF
    • Interleukin 10 related T cell derived inducible factor
    • interleukin 21
    • Interleukin 22
    • Interleukin-22
    • MGC79382
    • MGC79384
    • TIFa
    • TIFIL 23
    • TIFIL23
    • UNQ3099/PRO10096
    • zcyto18
    see all
  • Function

    Cytokine that contributes to the inflammatory response in vivo.
  • Sequence similarities

    Belongs to the IL-10 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab214995 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214995.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up