Description

  • Product name

    Recombinant Mouse IL-22 protein (His tag)
    See all IL-22 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGV SAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCH ISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      34 to 179
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature form without signal peptide. NP_058667.1

Specifications

Our Abpromise guarantee covers the use of ab215029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Reconstitute vial with 100 µL sterile water. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • Cytokine Zcyto18
    • IL 10 related T cell derived inducible factor
    • IL 21
    • IL 22
    • IL D110
    • IL TIF
    • IL-10-related T-cell-derived-inducible factor
    • IL-22
    • IL-TIF
    • IL21
    • Il22
    • IL22_HUMAN
    • ILD110
    • ILTIF
    • Interleukin 10 related T cell derived inducible factor
    • interleukin 21
    • Interleukin 22
    • Interleukin-22
    • MGC79382
    • MGC79384
    • TIFa
    • TIFIL 23
    • TIFIL23
    • UNQ3099/PRO10096
    • zcyto18
    see all
  • Function

    Cytokine that contributes to the inflammatory response in vivo.
  • Sequence similarities

    Belongs to the IL-10 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab215029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up