Description

  • Product name

    Recombinant Mouse IL-23 + IL-12B protein (His tag)
    See all IL-23+IL-12B proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Mouse
    • Sequence

      PRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRI QCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPM EQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQA FLAIAARVFAHGAATLTEPLVPTA
    • Predicted molecular weight

      21 kDa including tags
    • Amino acids

      23 to 196
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature form.
    • Amino Acid Sequence 2

    • Species

      Mouse
    • Sequence

      MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSG KTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKN KTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASL SAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYS TSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFV RIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSS CSKWACVPCRVRS
    • Predicted molecular weight

      36 kDa
    • Amino acids

      23 to 335
    • Additional sequence information

      Mature form. NP_032378.

Specifications

Our Abpromise guarantee covers the use of ab221233 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • IL23+IL12B
  • Cellular localization

    IL23: Secreted. Secreted upon association with IL12B. IL12B: Secreted.

Images

  • SDS-PAGE analysis of ab221233 under reducing conditions, stained overnight with Coomassie Blue. As a result of glycosylation, the reduced protein migrates at 21 kDa and 45-50 kDa.

References

This product has been referenced in:

  • Li Q  et al. Total Glycosides of Peony Protects Against Inflammatory Bowel Disease by Regulating IL-23/IL-17 Axis and Th17/Treg Balance. Am J Chin Med 47:177-201 (2019). Read more (PubMed: 30612460) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221233.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up