Bioactive grade

Recombinant mouse IL-25 protein (Animal Free) (ab218142)

Description

  • Product name

    Recombinant mouse IL-25 protein (Animal Free)
    See all IL-25 proteins and peptides
  • Biological activity

    The activity is determined by the dose-dependant production of IL8 from cultured Human PBMCs and is typically 10-100 ng/mL.  This corresponds to an expected specific activity of 1 x 105 units/mg.

  • Purity

    > 95 % SDS-PAGE.
    As determined by reducing and non-reducing SDS-PAGE.
  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAES CRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSH MDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRP RVMA
    • Predicted molecular weight

      35 kDa
    • Amino acids

      1 to 153
    • Additional sequence information

      Non-glycosylated, disulfide-linked homodimer, containing two amino acid chains.

Specifications

Our Abpromise guarantee covers the use of ab218142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as IL-17E

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at room temperature. Store at -20°C.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute the lyophilized product with sterile 10 mM HCl at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. Do not vortex. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • IL 17E
    • IL 25
    • IL-17E
    • IL-25
    • IL17e
    • IL25
    • IL25_HUMAN
    • Interleukin 17E
    • Interleukin 25
    • Interleukin-17E
    • Interleukin-25
    • Interleukin17E
    • Interleukin25
    • OTTHUMP00000027946
    • OTTHUMP00000246238
    • UNQ3120/PRO10272
    see all
  • Function

    Induces activation of NF-kappa-B and stimulates production of the proinflammatory chemokine IL-8. Proinflammatory cytokine favoring Th2-type immune responses.
  • Tissue specificity

    Expressed at low levels in several tissues, including brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea.
  • Sequence similarities

    Belongs to the IL-17 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab218142 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up