Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MSKLLFLSLALWASRSPGYTETALVALSQPRVQCHASRYPVAVDCSWTPL QAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVP YMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPP ASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQ VSAQDLTDYGKPSDWSLPGQVESAPHKPGGGGSFPTDPLSLQELRREFTV SLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHH LSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHR HLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSW PQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS
    • Molecular weight

      49 kDa including tags
    • Amino acids

      1 to 228
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Linked through a (glyglyglyglyser) 3 to mature P28/IL30 (phe 29ser 234; accession # NM_145636) tagged at the C-terminal with thrglyhis10 was expressed in human 293 cells.

Specifications

Our Abpromise guarantee covers the use of ab181962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured in a bioassay of IL­27­ mediated inhibition of IL­2 production by mouse splenocytes activated with immobilized anti-­CD3 and soluble anti­-CD28 antibodies (Villarino, A.V., et al. 2006. J. Immunol. 176: 237). The ED50 for this is typically 50 ng/ml, corresponding to a specific activity of 2.0 x 104 U/mg.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 0.010 Eu/ng
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    After removal of the secretion signal the mature EBI3 linker mature p28 His10 protein has a predicted molecular mass of approximately 49 kDa. On nonreducing and reducing SDS-PAGE the linked protein migrates as a 55 kDa protein due to glycosylation.

    Endotoxin Level: Less than 0.01 ng/ug cytokine, as determined by the LAL assay.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Add 1% BSA for extra stability. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 6
    Constituents: 0.28% Monobasic dihydrogen sodium phosphate, 3.51% Sodium chloride

    0.22 uM filtered.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • IL27-A+EBI3
  • Cellular localization

    IL27-A: Secreted. Does not seem to be secreted without coexpression of EBI3. EBI3: Secreted.

References

ab181962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up