Recombinant mouse IL-27-A + EBI3 protein (Fc Chimera Active) (ab214976)

Description

  • Product name

    Recombinant mouse IL-27-A + EBI3 protein (Fc Chimera Active)
  • Biological activity

    Bioactivity was measured in a cell proliferation assay of Con A activated mouse splenocytes.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Mouse
    • Sequence

      MSKLLFLSLALWASRSPGYTETALVALSQPRVQCHASRYPVAVDCSWTPL QAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVP YMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPP ASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQ VSAQDLTDYGKPSDWSLPGQVESAPHKP
    • Predicted molecular weight

      25 kDa
    • Amino acids

      1 to 228
    • Additional sequence information

      (NP_056581.1).
    • Amino Acid Sequence 2

    • Species

      Mouse
    • Sequence

      FPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLP LGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSS EREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKL PLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRP GSAWDS
    • Predicted molecular weight

      24 kDa
    • Amino acids

      29 to 234
    • Additional sequence information

      (AAI19403.1).

Specifications

Our Abpromise guarantee covers the use of ab214976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    The mouse IL-27 complex composed of the Ebi3 subunit (aa 1-228) and the p28 subunit (aa 29-234) is fused through a polypeptide linker to the Fc region of human IgG1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

    Constituent: 99% PBS

    Lyophilized from 0.2 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute at 100 µg/Ll in sterile PBS. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • IL27-A+EBI3
  • Cellular localization

    IL27-A: Secreted. Does not seem to be secreted without coexpression of EBI3. EBI3: Secreted.

References

ab214976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up