Description

  • Product name

    Recombinant mouse IL-3 protein
    See all IL-3 proteins and peptides
  • Biological activity

    The ED50 as determined by the dose-dependent stimulation of the proliferation ofmurine M-NFS-60 cells is < 0.05 ng/ml, corresponding to a specific activity of > 2 x107 units/mg.

  • Purity

    > 98 % SDS-PAGE.
    ab200268 is >98% pure as assessed by SDS-PAGE and HPLC analyses.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKF VESQGEVDPEDRYVIKSNLQLNCCLPTSANDSALPGVFIRDLDDFRKKLR FYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
    • Predicted molecular weight

      15 kDa
    • Amino acids

      33 to 166

Specifications

Our Abpromise guarantee covers the use of ab200268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Please see notes section.

    pH: 7.4
    Constituent: 100% PBS

    Lyophilized from a 0.2 mm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.

General Info

  • Alternative names

    • Colony stimulating factor multiple
    • Hematopoietic growth factor
    • IL 3
    • IL-3
    • IL3
    • IL3_HUMAN
    • Interleukin 3
    • Interleukin 3 (colony stimulating factor, multiple)
    • Interleukin-3
    • Mast cell growth factor
    • MCGF
    • MGC79398
    • MGC79399
    • Multi CSF
    • Multilineage colony stimulating factor
    • Multipotential colony stimulating factor
    • Multipotential colony-stimulating factor
    • OTTHUMP00000065963
    • P cell stimulating factor
    • P-cell-stimulating factor
    see all
  • Function

    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
    This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
  • Tissue specificity

    Activated T-cells, mast cells, natural killer cells.
  • Sequence similarities

    Belongs to the IL-3 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab200268 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up