Recombinant mouse IL-3 protein (ab200268)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: HPLC, Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant mouse IL-3 protein
See all IL-3 proteins and peptides -
Biological activity
The ED50 as determined by the dose-dependent stimulation of the proliferation ofmurine M-NFS-60 cells is < 0.05 ng/ml, corresponding to a specific activity of > 2 x107 units/mg.
-
Purity
> 98 % SDS-PAGE.
ab200268 is >98% pure as assessed by SDS-PAGE and HPLC analyses. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKF VESQGEVDPEDRYVIKSNLQLNCCLPTSANDSALPGVFIRDLDDFRKKLR FYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC -
Predicted molecular weight
15 kDa -
Amino acids
33 to 166
-
Specifications
Our Abpromise guarantee covers the use of ab200268 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Please see notes section. Store under desiccating conditions.
pH: 7.40
Constituent: 100% PBS
Lyophilized from a 0.2 mm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
General Info
-
Alternative names
- Colony stimulating factor multiple
- Hematopoietic growth factor
- IL 3
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. -
Tissue specificity
Activated T-cells, mast cells, natural killer cells. -
Sequence similarities
Belongs to the IL-3 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab200268 has not yet been referenced specifically in any publications.