Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMNENLEIWTLTQDKECDLTGYLRGKLQYKN RLQYMKHYFPINYRIAVPYEGVLRVANITRLQKAHVSERELRYLWVLVSL NATESVMDVLLEGHPSWKYLQEVQTLLENVQRSLMDVEIGPHVEAVLSLL STPGLSLKLVRPKALLDNCFRVMELLYCSCCKQSPILKWQDCELPRLHPH SPGSLMQCTATNVYPLSRQTPTSLPGSPSSSHGSLP
    • Molecular weight

      27 kDa including tags
    • Amino acids

      21 to 235
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 21 to 235. The signal peptide is not included (NP_001128572).

Specifications

Our Abpromise guarantee covers the use of ab202163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.
    ab202163 was purified by conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

    Previously labelled as Interleukin 34.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • C16orf77
    • Chromosome 16 open reading frame 77
    • FPT025
    • IL 34
    • IL-34
    • Il34
    • IL34_HUMAN
    • Interleukin 34
    • Interleukin-34
    • Interleukin34
    • MGC34647
    see all
  • Function

    Cytokine that promotes the differentiation and viability of monocytes and macrophages. Stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1. Ligand for colony-stimulating factor-1 receptor CSF1R.
  • Tissue specificity

    Detected in the sinusoidal epithelium in the red pulp of spleen (at protein level). Predominantly expressed in spleen. Also detected in a range of other tissues including heart, brain, lung, liver, kidney, thymus, testis, ovary, small intestine, prostate and colon.
  • Sequence similarities

    Belongs to the IL-34 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab202163.

References

ab202163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up