Description

  • Product name

    Recombinant mouse IL-36RN protein (Active)
    See all IL-36RN proteins and peptides
  • Biological activity

    Measured by its ability to inhibit secretion of IL-8 by A431 cells in the presence of human IL-36γ.

  • Purity

    > 98 % SDS-PAGE.
    >98 % by HPLC.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALD ASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFY RRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYF QQCD
    • Predicted molecular weight

      17 kDa
    • Amino acids

      3 to 156

Specifications

Our Abpromise guarantee covers the use of ab245800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 0.16% Sodium phosphate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in 5mM Sodium Phosphate, pH 7.4 to 0.1-1.0 mg/ml.

General Info

  • Alternative names

    • AI413231
    • Family of interleukin 1 delta
    • FIL1
    • FIL1 delta
    • FIL1(DELTA)
    • FIL1D
    • Fil1delta
    • I36RA_HUMAN
    • IL 1 delta
    • IL 1 related protein 3
    • IL 1F5 (IL 1HY1, FIL1 delta, IL 1RP3, IL 1L1, IL 1 delta)
    • Il 1h3
    • IL 1HY1
    • IL 1L1
    • IL 1ra homolog
    • IL 1ra homolog; IL1F5 (Canonical product IL 1F5a)
    • IL 1RP3
    • IL-1 delta
    • IL-1-related protein 3
    • IL-1F5
    • IL-1HY1
    • IL-1L1
    • IL-1ra homolog 1
    • IL-1RP3
    • IL1F5
    • IL1HY1
    • IL1L1
    • IL1RP3
    • IL36RA
    • IL36RN
    • Interleukin 1 delta
    • Interleukin 1 family member 5
    • Interleukin 1 family member 5 (delta)
    • Interleukin 1 HY1
    • Interleukin 1 like protein 1
    • Interleukin 1 receptor antagonist homolog 1
    • Interleukin 36 receptor antagonist
    • Interleukin-1 delta
    • Interleukin-1 family member 5
    • Interleukin-1 HY1
    • Interleukin-1 receptor antagonist homolog 1
    • Interleukin-1-like protein 1
    • Interleukin-36 receptor antagonist protein
    • MGC29840
    • PSORP
    • RP23-176J12.6
    see all
  • Function

    Is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to interleukin 1 family member 9 (IL1F9). Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response.
  • Tissue specificity

    Predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.
  • Involvement in disease

    Defects in IL36RN are the cause of psoriasis generalized pustular (PSORP) [MIM:614204]. PSORP is a life-threatening disease defined by repeated flares of sudden onset consisting of diffuse erythematous skin eruption characterized by rapid coverage with pustules, high-grade fever, asthenia, marked leukocytosis, and elevated serum levels of C-reactive protein.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab245800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up