Description

  • Product name

    Recombinant mouse IL-5 protein (Animal Free)
    See all IL-5 proteins and peptides
  • Biological activity

    The activity can be determined by the dose-dependent induction of TF-1 cell proliferation and is typically less than 1 ng/mL. This corresponds to an expected specific activity of 1 x 106 units/mg.

  • Purity

    > 97 % SDS-PAGE.

  • Endotoxin level

    > 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL DILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQE FLGVMSTEWAMEG
    • Predicted molecular weight

      26 kDa
    • Amino acids

      21 to 133
    • Additional sequence information

      This is the full length protein without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab205524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 9.00
    Constituent: 0.17% Sodium bicarbonate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the sterile water down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution.

General Info

  • Alternative names

    • B-cell differentiation factor I
    • Colony stimulating factor
    • EDF
    • Eosinophil differentiation factor
    • IL-5
    • IL5
    • IL5_HUMAN
    • Interleukin 5
    • Interleukin 5 (colony stimulating factor, eosinophil)
    • Interleukin-5
    • T Cell Replacing Factor
    • T-cell replacing factor
    • TRF
    see all
  • Function

    Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
  • Sequence similarities

    Belongs to the IL-5 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab205524 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up