Description

  • Product name

    Recombinant Mouse IL-5RA protein
    See all IL-5RA proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKIN APQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKA PPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYF LYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSK RAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCF NYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPG RWGEWSQPIYVGKERKSLVEWHLEHHHHHH
    • Predicted molecular weight

      38 kDa
    • Amino acids

      18 to 340
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab222449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CD125
    • CD125 antigen
    • CDw125
    • HSIL5R3
    • IL-5 receptor subunit alpha
    • IL-5R subunit alpha
    • IL-5R-alpha
    • IL-5RA
    • IL5R
    • IL5RA
    • IL5RA_HUMAN
    • Interleukin 5 Receptor alpha
    • Interleukin 5 Receptor alpha chain
    • Interleukin 5 receptor alpha subunit
    • Interleukin 5 receptor subunit alpha
    • Interleukin 5 receptor type 3
    • Interleukin-5 receptor subunit alpha
    • MGC26560
    see all
  • Function

    This is the receptor for interleukin-5. The alpha chain binds to IL5.
  • Tissue specificity

    Expressed on eosinophils and basophils.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 5 subfamily.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 3 μg ab222449 analyzed by 15% SDS-PAGE.

References

ab222449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up